{"product_id":"proteintech-16056-1-ap","title":"Proteintech, 16056-1-AP, SAP30L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAP30L (16056-1-AP) by Proteintech is a Polyclonal antibody targeting SAP30L in WB, ELISA applications with reactivity to human, mouse, rat samples\n16056-1-AP targets SAP30L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood platelets, mouse lung tissue,  rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSAP30L, also named as NS4ATP2, is one of the key proteins in a multi‐subunit protein complex involved in transcriptional regulation via histone deacetylation. SAP30L is an essential component of the Sin3A corepressor complex. The MW migrates to 26-30 kDa with phospho and SUMO modification and may generate complexes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9024 Product name: Recombinant human SAP30L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC009829 Sequence: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE Predict reactive species\nFull Name: SAP30-like\nCalculated Molecular Weight: 183 aa, 21 kDa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: BC009829\nGene Symbol: SAP30L\nGene ID (NCBI): 79685\nRRID: AB_3085479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HAJ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887792214185,"sku":"16056-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16056-1-ap","provider":"Iright","version":"1.0","type":"link"}