{"product_id":"proteintech-16061-1-ap","title":"Proteintech, 16061-1-AP, GINS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GINS1 (16061-1-AP) by Proteintech is a Polyclonal antibody targeting GINS1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16061-1-AP targets GINS1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, mouse testis tissue,  SH-SY5Y cells,  U-251 cells,  mouse thymus tissue,  rat testis tissue,  rat thymus tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGINS1, also known as Partner of SLD Five 1 (PSF1) is a member of the GINS (Go-Ichi-Nii-San) complex, which plays a vital role in the initiation and elongation of DNA replication (PMID: 34414190). GINS1 was initially found to be predominantly expressed in highly proliferating cells instead of mature cells. Later on, it was found that GINS was involved in the tumorigenesis of various cancers, including breast cancer, colorectal cancer, and hepatocellular carcinoma (PMID: 36065190).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8895 Product name: Recombinant human GINS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC012542 Sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS Predict reactive species\nFull Name: GINS complex subunit 1 (Psf1 homolog)\nCalculated Molecular Weight: 196 aa, 23 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC012542\nGene Symbol: GINS1\nGene ID (NCBI): 9837\nRRID: AB_3669229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14691\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887651180713,"sku":"16061-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16061-1-ap","provider":"Iright","version":"1.0","type":"link"}