{"product_id":"proteintech-16094-1-ap","title":"Proteintech, 16094-1-AP, KPTN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KPTN (16094-1-AP) by Proteintech is a Polyclonal antibody targeting KPTN in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16094-1-AP targets KPTN in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  human cerebellum tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human kidney tissue,  human heart tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKaptin, also named as KPTN and Actin-associated protein 2E4, originally isolated from human blood platelets and likely to be involved in the actin rearrangements occurring during activation. It plays a unique role in the actin rearrangements that accompany platelet activation and stereocilia formation. Kaptin is necessary for normal neuromorphogenesis. It may play a role in producing the sensory apparatus in hair cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8785 Product name: Recombinant human KPTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-436 aa of BC009249 Sequence: EIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS Predict reactive species\nFull Name: kaptin (actin binding protein)\nCalculated Molecular Weight: 436 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC009249\nGene Symbol: KPTN\nGene ID (NCBI): 11133\nRRID: AB_2134007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y664\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868918829225,"sku":"16094-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16094-1-ap","provider":"Iright","version":"1.0","type":"link"}