{"product_id":"proteintech-16127-1-ap","title":"Proteintech, 16127-1-AP, CLMP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLMP (16127-1-AP) by Proteintech is a Polyclonal antibody targeting CLMP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16127-1-AP targets CLMP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, 3T3-L1 cells,  rat brain tissue\nPositive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLMP (Coxsackie- and adenovirus receptor-like membrane protein), also known as ACAM (adipocyte adhesion molecule) or ASAM, is a member of the CTX (cortical thymocyte marker in Xenopus) family of proteins. CTX family proteins are type I transmembrane proteins within the Ig superfamily that localize to junctional complexes between endothelial and epithelial cells and may play a role in cell-cell adhesion. CLMP is predominantly expressed in epithelial cells within different tissues and in the white adipose tissue. It may be involved in the cell-cell adhesion and may play a role in adipocyte differentiation and development of obesity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9111 Product name: Recombinant human ASAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-229 aa of BC009371 Sequence: EIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQ Predict reactive species\nFull Name: adipocyte-specific adhesion molecule\nCalculated Molecular Weight: 373 aa, 41 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC009371\nGene Symbol: CLMP\nGene ID (NCBI): 79827\nRRID: AB_2878221\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6B4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869657026729,"sku":"16127-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16127-1-ap","provider":"Iright","version":"1.0","type":"link"}