{"product_id":"proteintech-16133-1-ap","title":"Proteintech, 16133-1-AP, MUL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MUL1 (16133-1-AP) by Proteintech is a Polyclonal antibody targeting MUL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16133-1-AP targets MUL1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial ubiquitin ligase 1 (MUL1),MAPL, MULAN, or gGIDE, was identified as an E3 protein ligase by three independent groups. Work in mammalian systems shows that MUL1 has small ubiquitin-like modifier (SUMO) ligase activity, stabilizing Drp1, or ubiquitin ligase activity, degrading Mfn. MUL1 expression in mammalian cells results in smaller and more fragmented mitochondria.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9119 Product name: Recombinant human MUL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-239 aa of BC010101 Sequence: SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL Predict reactive species\nFull Name: mitochondrial E3 ubiquitin ligase 1\nCalculated Molecular Weight: 352 aa, 40 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC010101\nGene Symbol: MUL1\nGene ID (NCBI): 79594\nRRID: AB_2147111\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969V5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868919517353,"sku":"16133-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16133-1-ap","provider":"Iright","version":"1.0","type":"link"}