{"product_id":"proteintech-16146-1-ap","title":"Proteintech, 16146-1-AP, LYPLAL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYPLAL1 (16146-1-AP) by Proteintech is a Polyclonal antibody targeting LYPLAL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16146-1-AP targets LYPLAL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells\nPositive IHC detected in: human liver cancer tissue, mouse kidney tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLysophospholipase-like 1 protein, encoded by LYPLAL1, a 26 kDa cytosol protein which belongs to a subclass of lysophospholipase family. Human genome-wide association studies link variants of the gene encoding this enzyme to fat distribution, waist-to-hip ratio and non-alcoholic fatty liver disease. LYPLAL1 reported to be up-regulated in subcutaneous adipose tissue of obese individuals.(PMID: 25958046, PMID: 27391855, PMID: 21674055)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9271 Product name: Recombinant human LYPLAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC016711 Sequence: MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK Predict reactive species\nFull Name: lysophospholipase-like 1\nCalculated Molecular Weight: 237 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC016711\nGene Symbol: LYPLAL1\nGene ID (NCBI): 127018\nRRID: AB_2138521\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VWZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869415067817,"sku":"16146-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16146-1-ap","provider":"Iright","version":"1.0","type":"link"}