{"product_id":"proteintech-16208-1-ap","title":"Proteintech, 16208-1-AP, MTF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTF2 (16208-1-AP) by Proteintech is a Polyclonal antibody targeting MTF2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16208-1-AP targets MTF2 in WB, IHC, IF\/ICC, IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  mouse ES cells and 293 cells\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: mouse ES cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTF2, also named as Metal-response element-binding transcription factor 2, is a 593 amino acid protein. It exists several isoforms and the range of the molecular weight of isoforms are about 55-60 kDa and 29 kDa. MTF2 contains 2 PHD-type zinc fingers and belongs to the Polycomblike family. MTF2 acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity and regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9182 Product name: Recombinant human MTF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-536 aa of BC010013 Sequence: ADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS Predict reactive species\nFull Name: metal response element binding transcription factor 2\nCalculated Molecular Weight: 536 aa, 61 kDa\nObserved Molecular Weight: 67 kDa, 60 kDa, 60-61 kDa\nGenBank Accession Number: BC010013\nGene Symbol: MTF2\nGene ID (NCBI): 22823\nRRID: AB_2147370\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y483\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861845673,"sku":"16208-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16208-1-ap","provider":"Iright","version":"1.0","type":"link"}