{"product_id":"proteintech-16209-1-ap","title":"Proteintech, 16209-1-AP, GGCX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GGCX (16209-1-AP) by Proteintech is a Polyclonal antibody targeting GGCX in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16209-1-AP targets GGCX in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  HEK-293 cells,  HepG2 cells,  L02 cells,  MCF-7 cells,  mouse liver tissue,  PC-3 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGGCX(Gamma-glutamyl carboxylase) is also named as GC and belongs to the vitamin K-dependent gamma-carboxylase family. This 94 kDa (including all modifications, such as the five N-linked glycosylations), is a 5-pass transmembrane protein and a key regulator of blood coagulation(PMID:20518534). It mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. Defects in GGCX are a cause of combined deficiency of vitamin K-dependent clotting factors type 1 (VKCFD1) and pseudoxanthoma elasticum-like disorder with multiple coagulation factor deficiency (PXEL-MCFD)(PMID:9845520;17110937).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9185 Product name: Recombinant human GGCX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 383-758 aa of BC013979 Sequence: LTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF Predict reactive species\nFull Name: gamma-glutamyl carboxylase\nCalculated Molecular Weight: 758 aa, 88 kDa\nObserved Molecular Weight: 88 kDa\nGenBank Accession Number: BC013979\nGene Symbol: GGCX\nGene ID (NCBI): 2677\nRRID: AB_2110874\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P38435\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868917878953,"sku":"16209-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16209-1-ap","provider":"Iright","version":"1.0","type":"link"}