{"product_id":"proteintech-16235-1-ap","title":"Proteintech, 16235-1-AP, MRPS18A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPS18A (16235-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS18A in WB, IHC, ELISA applications with reactivity to human samples\n16235-1-AP targets MRPS18A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  L02 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRPS18A (Mitochondrial Ribosomal Protein S18A) is a protein coding gene. It encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The increased expression of MRPS18A in cancer cells is explained by the increased energy metabolism of cancer cells and may pave the way for new diagnostic and therapeutic avenues to be explored (PMID: 28056857).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8981 Product name: Recombinant human MRPS18A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-196 aa of BC010364 Sequence: MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH Predict reactive species\nFull Name: mitochondrial ribosomal protein S18A\nCalculated Molecular Weight: 196 aa, 22 kDa\nObserved Molecular Weight: 18-22 kDa\nGenBank Accession Number: BC010364\nGene Symbol: MRPS18A\nGene ID (NCBI): 55168\nRRID: AB_2266663\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVS2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869712699561,"sku":"16235-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16235-1-ap","provider":"Iright","version":"1.0","type":"link"}