{"product_id":"proteintech-16246-1-ap","title":"Proteintech, 16246-1-AP, SAT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAT2 (16246-1-AP) by Proteintech is a Polyclonal antibody targeting SAT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16246-1-AP targets SAT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSpermidine\/spermine N1-acetyltransferase 2 (SAT2) is a short-lived polyamine catabolic enzyme inducible by polyamines and polyamine analogues. Human SAT2 contains the highly conserved acetyl-CoA-binding domain and displays coactivator function to enhance NF-κB-dependent transcription and  enhances TNFα-induced NF-κB activity (PMID: 17875644). Human SAT1 and SAT2 proteins, which share 46% amino acid sequence identity and are clearly homologous, both interact with HIF-1α and both promote the ubiquitination and degradation of HIF-1α (PMID: 17011643).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9179 Product name: Recombinant human SAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC011751 Sequence: MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK Predict reactive species\nFull Name: spermidine\/spermine N1-acetyltransferase family member 2\nCalculated Molecular Weight: 170 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC011751\nGene Symbol: SAT2\nGene ID (NCBI): 112483\nRRID: AB_2254874\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96F10\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869594472617,"sku":"16246-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16246-1-ap","provider":"Iright","version":"1.0","type":"link"}