{"product_id":"proteintech-16258-1-ap","title":"Proteintech, 16258-1-AP, RGS14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGS14 (16258-1-AP) by Proteintech is a Polyclonal antibody targeting RGS14 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n16258-1-AP targets RGS14 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  mouse brain tissue,  mouse spleen tissue,  HepG2 cells,  HuH-7 cells,  mouse liver tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRGS14, a member of the R12 subfamily of RGS proteins, is highly expressed in the brain and is a natural suppressor of CA2 hippocampal synaptic plasticity and learning and memory. RGS14 was first identified as a complex scaffolding protein with an unconventional domain structure that allows it to interact with various protein binding partners. RGS14 contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9292 Product name: Recombinant human RGS14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-566 aa of BC014094 Sequence: KSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL Predict reactive species\nFull Name: regulator of G-protein signaling 14\nCalculated Molecular Weight: 566 aa, 61 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC014094\nGene Symbol: RGS14\nGene ID (NCBI): 10636\nRRID: AB_2179918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43566\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920565929,"sku":"16258-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16258-1-ap","provider":"Iright","version":"1.0","type":"link"}