{"product_id":"proteintech-16262-1-ap","title":"Proteintech, 16262-1-AP, MED28 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED28 (16262-1-AP) by Proteintech is a Polyclonal antibody targeting MED28 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16262-1-AP targets MED28 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, PC-12 cells,  rat testis tissue\nPositive IHC detected in: mouse testis tissue, mouse brain tissue,  human kidney tissue,  human placenta tissue,  human testis tissue,  human brain tissue,  human liver tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9327 Product name: Recombinant human MED28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC011936 Sequence: MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT Predict reactive species\nFull Name: mediator complex subunit 28\nCalculated Molecular Weight: 178 aa, 20 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC011936\nGene Symbol: MED28\nGene ID (NCBI): 80306\nRRID: AB_2281863\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H204\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887715864745,"sku":"16262-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16262-1-ap","provider":"Iright","version":"1.0","type":"link"}