{"product_id":"proteintech-16282-1-ap","title":"Proteintech, 16282-1-AP, GNPNAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNPNAT1 (16282-1-AP) by Proteintech is a Polyclonal antibody targeting GNPNAT1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16282-1-AP targets GNPNAT1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, mouse large intestine tissue,  MDA-MB-231 cells,  mouse colon tissue\nPositive IP detected in: mouse large intestine tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucosamine-6 phosphate-N-acetyl Transferase (GNPNAT1) is a key enzyme in the hexosamine biosynthetic pathway. It converts D-glucosamine 6-phosphate to N-acetyl-D-glucosamine 6-phosphate, the acetylation step allowing carbon and nitrogen enter into the hexosamine biosynthetic pathway. Recently inhibition of GNPNAT1 has been reported to promote proliferation and aggressiveness of castration-resistant prostate cancer. (27194471) GNPNAT1 is a small dimeric protein localized in the Golgi and endosome membranes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9375 Product name: Recombinant human GNPNAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC012179 Sequence: MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK Predict reactive species\nFull Name: glucosamine-phosphate N-acetyltransferase 1\nCalculated Molecular Weight: 184 aa, 21 kDa\nObserved Molecular Weight: 21-23 kDa\nGenBank Accession Number: BC012179\nGene Symbol: GNPNAT1\nGene ID (NCBI): 64841\nRRID: AB_2110243\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924858537,"sku":"16282-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16282-1-ap","provider":"Iright","version":"1.0","type":"link"}