{"product_id":"proteintech-16285-1-ap","title":"Proteintech, 16285-1-AP, HN1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HN1L (16285-1-AP) by Proteintech is a Polyclonal antibody targeting HN1L in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n16285-1-AP targets HN1L in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHematological and neurological expressed 1-like protein (HN1L), also known as Jupiter microtubule-associated homolog 2 (JPT2), belongs to the jupiter family. HN1L is nicotinic acid adenine dinucleotide phosphate (NAADP) binding protein required for NAADP-evoked intracellular calcium release (PubMed:33758061). HN1L enables NAADP to activate Ca2+ release from the endoplasmic reticulum through ryanodine receptors (PubMed:33758062). HN1L was also required for the translocation of a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) pseudovirus through the endolysosomal systemHN1L is expressed in liver, kidney, prostate, testis and uterus (PMID: 15094197).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9400 Product name: Recombinant human HN1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC014438 Sequence: MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY Predict reactive species\nFull Name: hematological and neurological expressed 1-like\nCalculated Molecular Weight: 190 aa, 20 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC014438\nGene Symbol: HN1L\nGene ID (NCBI): 90861\nRRID: AB_3085484\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H910\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887669596329,"sku":"16285-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16285-1-ap","provider":"Iright","version":"1.0","type":"link"}