{"product_id":"proteintech-16287-1-ap","title":"Proteintech, 16287-1-AP, MYL12A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL12A (16287-1-AP) by Proteintech is a Polyclonal antibody targeting MYL12A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16287-1-AP targets MYL12A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyosin II is an actin-binding protein composed of MHC (myosin heavy chain), MLCs\/MRLCs (myosin regulatory light chains) and ELCs (essential light chains). The Myosin Light Chains are divided into basic MLC (MLC I) and regulatory MLC (MLC II or Myosin Regulatory Light Chain, MRLC). MRLC can be classified into two major types: : class I MRLC found in muscles (MLC1, MLC2, MLC3, MYL4, MYL5, MYL6, MYL7, etc), and class II MRLCs present in non-muscle cells (such as MYL9, MYL12A, MYL12B).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig, frog\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9413 Product name: Recombinant human MYL12A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC016372 Sequence: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD Predict reactive species\nFull Name: myosin, light chain 12A, regulatory, non-sarcomeric\nCalculated Molecular Weight: 171 aa, 20 kDa\nObserved Molecular Weight: 19-20 kDa\nGenBank Accession Number: BC016372\nGene Symbol: MYL12A\nGene ID (NCBI): 10627\nRRID: AB_2878238\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19105\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005271209,"sku":"16287-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16287-1-ap","provider":"Iright","version":"1.0","type":"link"}