{"product_id":"proteintech-16302-1-ap","title":"Proteintech, 16302-1-AP, Claudin 15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 15 (16302-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 15 in WB, ELISA applications with reactivity to human, mouse, rat samples\n16302-1-AP targets Claudin 15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, mouse small intestine tissue,  rat colon tissue,  rat small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudins are a family of proteins that are the most important components of tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 claudins have been identified. They are small (20-27 kilodalton (kDa))  proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin family member Claudin-15 is a classic tight junction molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9124 Product name: Recombinant human CLDN15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC010160 Sequence: MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGSTDSPASLSGGTGLLVRLMSIKGPCEGRRLASCRLSVRCKEAVCVQGIFRPAGHS Predict reactive species\nFull Name: claudin 15\nCalculated Molecular Weight: 128aa,14 kDa; 228aa,24 kDa\nObserved Molecular Weight: 24-26 kDa\nGenBank Accession Number: BC010160\nGene Symbol: Claudin 15\nGene ID (NCBI): 24146\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56746\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886591856809,"sku":"16302-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16302-1-ap","provider":"Iright","version":"1.0","type":"link"}