{"product_id":"proteintech-16307-1-ap","title":"Proteintech, 16307-1-AP, ATP5L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP5L (16307-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16307-1-AP targets ATP5L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5L gene encodes ATP synthase subunit g of the Fo complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9287 Product name: Recombinant human ATP5L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC015128 Sequence: MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIANSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC015128\nGene Symbol: ATP5L\nGene ID (NCBI): 10632\nRRID: AB_10699871\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75964\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993179817,"sku":"16307-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16307-1-ap","provider":"Iright","version":"1.0","type":"link"}