{"product_id":"proteintech-16332-1-ap","title":"Proteintech, 16332-1-AP, GUSB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GUSB (16332-1-AP) by Proteintech is a Polyclonal antibody targeting GUSB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16332-1-AP targets GUSB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse liver tissue,  HL-60 cells,  mouse heart tissue,  K-562 cells,  rat liver tissue\nPositive IHC detected in: human colon cancer tissue,  human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe GUSB gene encodes beta-glucuronidase, a lysosomal hydrolase involved in the stepwise degradation of glucuronic acid-containing glycosaminoglycans. It is a tetrameric glycoprotein composed of identical subunits. GUSB plays an important role in the degradation of dermatan and keratan sulfates. GUSB has two isoforms with the molecular mass of 75 kDa and 69 kDa, and it always can be detected as 78 kDa, 60 kDa and 18 kDa. The 60 kDa and 18 kDa polypeptides are derived by nicking 78-kDa GUSB subunit at Val159-Gly160 (PMID: 1311180, 9268591).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9453 Product name: Recombinant human GUSB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-651 aa of BC014142 Sequence: SLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKGFDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVTFVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSEYGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTRVLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT Predict reactive species\nFull Name: glucuronidase, beta\nCalculated Molecular Weight: 651 aa, 75 kDa\nObserved Molecular Weight: 78 kDa\nGenBank Accession Number: BC014142\nGene Symbol: GUSB\nGene ID (NCBI): 2990\nRRID: AB_2279538\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08236\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868967194793,"sku":"16332-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16332-1-ap","provider":"Iright","version":"1.0","type":"link"}