{"product_id":"proteintech-16337-1-ap","title":"Proteintech, 16337-1-AP, CD157 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD157 (16337-1-AP) by Proteintech is a Polyclonal antibody targeting CD157 in WB, IHC, ELISA applications with reactivity to human samples\n16337-1-AP targets CD157 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, RAW 264.7 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBST-1(bone marrow stromal cell antigen 1), also named as CD157 or ADP-ribosyl cyclase 2, is a glycosyl phosphotidylinositol-anchored protein that stimulates pre-B-cell growth and has adenosine diphosphate (ADP)-ribosyl cyclase and cyclic ADP-ribose (cADPR) hydrolase activity (PMID: 9473467, 11866528). The two enzymatic activities are responsible for the synthesis and hydrolysis of cADPR, a novel second messenger of calcium release from intracellular calcium stores. BST-1 has a calculated molecular mass of 30-36 kDa and an apparent molecular mass of 40-46 kDa due to the glycosylation (PMID: 8941363, 10491089).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9491 Product name: Recombinant human BST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-318 aa of BC012095 Sequence: SAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL Predict reactive species\nFull Name: bone marrow stromal cell antigen 1\nCalculated Molecular Weight: 318 aa, 36 kDa\nObserved Molecular Weight: 39-46 kDa\nGenBank Accession Number: BC012095\nGene Symbol: CD157\nGene ID (NCBI): 683\nRRID: AB_2878244\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q10588\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869652406441,"sku":"16337-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16337-1-ap","provider":"Iright","version":"1.0","type":"link"}