{"product_id":"proteintech-16375-1-ap","title":"Proteintech, 16375-1-AP, HARS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HARS (16375-1-AP) by Proteintech is a Polyclonal antibody targeting HARS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16375-1-AP targets HARS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HeLa cells,  human kidney tissue,  K-562 cells,  mouse brain tissue,  mouse heart tissue,  mouse lung tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHARS is a cytoplasmic enzyme that belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. HARS is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis\/dermatomyositis. The D364Y (Asp364-to-Tyr) mutation of HARS1 inhibits morphological differentiation of neuronal cells (PMID: 35380399).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9333 Product name: Recombinant human HARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC011807 Sequence: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQ Predict reactive species\nFull Name: histidyl-tRNA synthetase\nCalculated Molecular Weight: 509 aa, 57 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC011807\nGene Symbol: HARS\nGene ID (NCBI): 3035\nRRID: AB_2116283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12081\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868981285033,"sku":"16375-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16375-1-ap","provider":"Iright","version":"1.0","type":"link"}