{"product_id":"proteintech-16394-1-ap","title":"Proteintech, 16394-1-AP, MRPL44 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPL44 (16394-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL44 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16394-1-AP targets MRPL44 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, rat brain tissue,  HeLa cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRP-L44 (mitochondrial ribosomal protein L44) is a 332 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 39S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey, zebrafish, yeast\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9485 Product name: Recombinant human MRPL44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC012058 Sequence: MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEE Predict reactive species\nFull Name: mitochondrial ribosomal protein L44\nCalculated Molecular Weight: 332 aa, 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC012058\nGene Symbol: MRPL44\nGene ID (NCBI): 65080\nRRID: AB_2146062\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H9J2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868850442409,"sku":"16394-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16394-1-ap","provider":"Iright","version":"1.0","type":"link"}