{"product_id":"proteintech-16403-1-ap","title":"Proteintech, 16403-1-AP, POLR2J Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLR2J (16403-1-AP) by Proteintech is a Polyclonal antibody targeting POLR2J in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16403-1-AP targets POLR2J in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human brain tissue,  HeLa cells,  MCF-7 cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9520 Product name: Recombinant human POLR2J protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC024165 Sequence: MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG Predict reactive species\nFull Name: polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa\nCalculated Molecular Weight: 115 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC024165\nGene Symbol: POLR2J\nGene ID (NCBI): 5439\nRRID: AB_10666162\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52435\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869007597737,"sku":"16403-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16403-1-ap","provider":"Iright","version":"1.0","type":"link"}