{"product_id":"proteintech-16425-1-ap","title":"Proteintech, 16425-1-AP, RNASE6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNASE6 (16425-1-AP) by Proteintech is a Polyclonal antibody targeting RNASE6 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n16425-1-AP targets RNASE6 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRnase6, a protein belonging to the superfamily, is considered the only vertebrate specific enzyme known to have a wide range of physiological functions, including digestion, cytotoxicity, angiogenesis, male reproduction, and host defense. Rnase6 expression was upregulated in the peripheral blood and plaque tissues of AS patients (PMID: 34395402).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9667 Product name: Recombinant human RNASE6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-150 aa of BC020848 Sequence: WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL Predict reactive species\nFull Name: ribonuclease, RNase A family, k6\nCalculated Molecular Weight: 150 aa, 17 kDa\nGenBank Accession Number: BC020848\nGene Symbol: RNASE6\nGene ID (NCBI): 6039\nRRID: AB_3669243\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q93091\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887785791657,"sku":"16425-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16425-1-ap","provider":"Iright","version":"1.0","type":"link"}