{"product_id":"proteintech-16462-1-ap","title":"Proteintech, 16462-1-AP, XPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XPA (16462-1-AP) by Proteintech is a Polyclonal antibody targeting XPA in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n16462-1-AP targets XPA in WB, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, HeLa cells,  MCF-7 cells\nPositive IP detected in: L02 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXPA, also named as DNA repair protein complementing XP-A cells, is a 272 amino acid protein, which belongs to the XPA family. XPA is expressed in various cell lines and in skin fibroblasts. XPA is involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. XPA is required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation. The calculated molecular weight of XPA is 31 kDa, but modified XPA protein is about 40 kDa (PMID: 17848622).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9536 Product name: Recombinant human XPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC014965 Sequence: MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM Predict reactive species\nFull Name: xeroderma pigmentosum, complementation group A\nCalculated Molecular Weight: 374aa,42 kDa; 273aa,31 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC014965\nGene Symbol: XPA\nGene ID (NCBI): 7507\nRRID: AB_2878261\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23025\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962050217,"sku":"16462-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16462-1-ap","provider":"Iright","version":"1.0","type":"link"}