{"product_id":"proteintech-16505-1-ap","title":"Proteintech, 16505-1-AP, FBXL8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXL8 (16505-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL8 in IHC, IP, ELISA applications with reactivity to human, mouse samples\n16505-1-AP targets FBXL8 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HCT 116 cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXL8 is a conserved F-box protein that belongs to the ubiquitin ligase complex. It plays a significant role in various cellular processes, including tumorigenesis and metastasis. In colorectal cancer, FBXL8 promotes liver metastasis and stem-cell-like features by mediating ubiquitination and degradation of TP53. Additionally, FBXL8 has been shown to inhibit lymphoma growth and hematopoietic malignancies by targeting specific substrates for degradation. In the context of cardiac fibrosis, FBXL8 inhibits post-myocardial infarction cardiac fibrosis by regulating the ubiquitination of key proteins (PMID: 36855778, PMID: 33122824, PMID: 38615011).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9685 Product name: Recombinant human FBXL8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-374 aa of BC014414 Sequence: MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA Predict reactive species\nFull Name: F-box and leucine-rich repeat protein 8\nCalculated Molecular Weight: 374 aa, 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC014414\nGene Symbol: FBXL8\nGene ID (NCBI): 55336\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CD0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887636402345,"sku":"16505-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16505-1-ap","provider":"Iright","version":"1.0","type":"link"}