{"product_id":"proteintech-16512-1-ap","title":"Proteintech, 16512-1-AP, HSP10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSP10 (16512-1-AP) by Proteintech is a Polyclonal antibody targeting HSP10 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n16512-1-AP targets HSP10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2\nPositive IHC detected in: human lung cancer tissue, mouse adrenal gland tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9732 Product name: Recombinant human HSPE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC023518 Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD Predict reactive species\nFull Name: heat shock 10kDa protein 1 (chaperonin 10)\nCalculated Molecular Weight: 102 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC023518\nGene Symbol: HSP10\nGene ID (NCBI): 3336\nRRID: AB_3085493\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61604\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887672250537,"sku":"16512-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16512-1-ap","provider":"Iright","version":"1.0","type":"link"}