{"product_id":"proteintech-16518-1-ap","title":"Proteintech, 16518-1-AP, RNASEH2C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNASEH2C (16518-1-AP) by Proteintech is a Polyclonal antibody targeting RNASEH2C in WB, IP, IHC, ELISA applications with reactivity to human samples\n16518-1-AP targets RNASEH2C in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  human spleen tissue,  human testis tissue,  HeLa cells,  Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human brain tissue,  human lung tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9739 Product name: Recombinant human RNASEH2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC023588 Sequence: MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED Predict reactive species\nFull Name: ribonuclease H2, subunit C\nCalculated Molecular Weight: 164 aa, 18 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC023588\nGene Symbol: RNASEH2C\nGene ID (NCBI): 84153\nRRID: AB_2181648\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDP1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987936937,"sku":"16518-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16518-1-ap","provider":"Iright","version":"1.0","type":"link"}