{"product_id":"proteintech-16616-1-ap","title":"Proteintech, 16616-1-AP, LAG-3\/CD223 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAG-3\/CD223 (16616-1-AP) by Proteintech is a Polyclonal antibody targeting LAG-3\/CD223 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n16616-1-AP targets LAG-3\/CD223 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PHA treated human PBMCs\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAG-3, also known as CD223, is an immune checkpoint molecule that regulates both T-cell activation and homeostasis. LAG-3 is expressed on activated T cells, NK cells, regulatory T cells, and plasmacytoid dendritic cells. It is a CD4-related molecule that binds MHC class II. LAG-3 plays an important role in modulating T cell expansion and function, and blockade of LAG-3 with monoclonal antibodies can augment T cell function. (PMID: 15634887; 21086108; 28783703)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9909 Product name: Recombinant human LAG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-360 aa of BC052589 Sequence: AEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE Predict reactive species\nFull Name: lymphocyte-activation gene 3\nCalculated Molecular Weight: 525 aa, 57 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC052589\nGene Symbol: LAG-3\nGene ID (NCBI): 3902\nRRID: AB_2133350\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18627\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902772905,"sku":"16616-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16616-1-ap","provider":"Iright","version":"1.0","type":"link"}