{"product_id":"proteintech-16637-1-ap","title":"Proteintech, 16637-1-AP, AHNAK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AHNAK (16637-1-AP) by Proteintech is a Polyclonal antibody targeting AHNAK in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n16637-1-AP targets AHNAK in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IHC detected in: human oesophagus cancer tissue, mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAHNAK, also known as desmoyokin, is described as a giant scaffold protein based on its large size (629 kDa) and ability to interact with different proteins to form multi-protein complexes. The bulk of the protein is assembled in 128-residue repetitive elements known as the central repeated\nunit (CRU). Its proposed functions are quite diverse, ranging from a role in the formation of the blood brain barrier, in cell architecture and migration, to the regulation of cardiac channels and muscle membrane repair. AHNAK is differentially expressed in some cancer cell lines. The expression of AHNAK is subsequently localized to the plasma membrane of keratinocytes in human epidermis. AHNAK has been reported in many intracellular locations including the nucleus, cytoplasm and plasma membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9986 Product name: Recombinant human AHNAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC000926 Sequence: MEKEEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLNTPQPSALECKDQNKQKEASSQAGAVSVSTPNAG Predict reactive species\nFull Name: AHNAK nucleoprotein\nCalculated Molecular Weight: 629 kDa\nGenBank Accession Number: BC000926\nGene Symbol: AHNAK\nGene ID (NCBI): 79026\nENSEMBL Gene ID: ENSG00000124942\nRRID: AB_2878291\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q09666\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869392097449,"sku":"16637-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16637-1-ap","provider":"Iright","version":"1.0","type":"link"}