{"product_id":"proteintech-16677-1-ap","title":"Proteintech, 16677-1-AP, CD244 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD244 (16677-1-AP) by Proteintech is a Polyclonal antibody targeting CD244 in WB, ELISA applications with reactivity to human samples\n16677-1-AP targets CD244 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NK-92 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD244, also known as SLAMF4 or 2B4, is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family. It consists of an extracellular segment with two immunoglobulin (Ig)-like domains, a transmembrane region, and a cytoplasmic domain containing tyrosine-based motifs (PMID: 9841922; 30546369). CD244 is present on natural killer (NK) cells, γδ T cells, a subset of CD8+ T cells, monocytes, basophils, dendritic cells, and myeloid-derived suppressor cells (MDSCs) (PMID: 30546369). It binds to CD48 with high affinity and transmits stimulatory or inhibitory signals that regulate immune function (PMID: 9841922; 18523281).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9860 Product name: Recombinant human CD244 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-220 aa of BC053985 Sequence: GCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEF Predict reactive species\nFull Name: CD244 molecule, natural killer cell receptor 2B4\nCalculated Molecular Weight: 365 aa, 41 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC053985\nGene Symbol: CD244\nGene ID (NCBI): 51744\nRRID: AB_2878297\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869522841769,"sku":"16677-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16677-1-ap","provider":"Iright","version":"1.0","type":"link"}