{"product_id":"proteintech-16689-1-ap","title":"Proteintech, 16689-1-AP, TOMM6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOMM6 (16689-1-AP) by Proteintech is a Polyclonal antibody targeting TOMM6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16689-1-AP targets TOMM6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOMM6, also named as OBTP and TOM6, is a part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10037 Product name: Recombinant human TOMM6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC018624 Sequence: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV Predict reactive species\nFull Name: translocase of outer mitochondrial membrane 6 homolog (yeast)\nCalculated Molecular Weight: 74 aa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC018624\nGene Symbol: TOMM6\nGene ID (NCBI): 100188893\nRRID: AB_2240919\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96B49\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869779841193,"sku":"16689-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16689-1-ap","provider":"Iright","version":"1.0","type":"link"}