{"product_id":"proteintech-16708-1-ap","title":"Proteintech, 16708-1-AP, HSPC159 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPC159 (16708-1-AP) by Proteintech is a Polyclonal antibody targeting HSPC159 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n16708-1-AP targets HSPC159 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, pig brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPC159 is a novel human galectin‐related protein (also known as GRP) that is mapped to human chromosome 2p13. The HSPC159 gene was originally deduced by partial sequence alignment and confirmed by a full‐length sequence for an mRNA isolated from CD34+ hematopoietic stem cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10109 Product name: Recombinant human HSPC159 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC062691 Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG Predict reactive species\nFull Name: galectin-related protein\nCalculated Molecular Weight: 172 aa, 19 kDa\nObserved Molecular Weight: 20 kDa, 27 kDa\nGenBank Accession Number: BC062691\nGene Symbol: HSPC159\nGene ID (NCBI): 29094\nRRID: AB_3085506\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3ZCW2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887673233577,"sku":"16708-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16708-1-ap","provider":"Iright","version":"1.0","type":"link"}