{"product_id":"proteintech-16717-1-ap","title":"Proteintech, 16717-1-AP, ARPC5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARPC5 (16717-1-AP) by Proteintech is a Polyclonal antibody targeting ARPC5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16717-1-AP targets ARPC5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  mouse thymus tissue\nPositive IHC detected in: mouse kidney tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10144 Product name: Recombinant human ARPC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC057237 Sequence: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV Predict reactive species\nFull Name: actin related protein 2\/3 complex, subunit 5, 16kDa\nCalculated Molecular Weight: 154 aa, 17 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC057237\nGene Symbol: ARPC5\nGene ID (NCBI): 10092\nRRID: AB_1850902\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15511\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977156265,"sku":"16717-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16717-1-ap","provider":"Iright","version":"1.0","type":"link"}