{"product_id":"proteintech-16719-1-ap","title":"Proteintech, 16719-1-AP, OBFC2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OBFC2A (16719-1-AP) by Proteintech is a Polyclonal antibody targeting OBFC2A in WB, ELISA applications with reactivity to human, mouse, rat samples\n16719-1-AP targets OBFC2A in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSingle-stranded DNA (ssDNA)-binding proteins (SSBs) are ubiquitous and essential for a variety of DNA metabolic processes, including recombination, replication, and detection and repair of damage. SSBs have multiple roles in binding and sequestering ssDNA, detecting DNA damage, stimulating nucleases, helicases and strand-exchange proteins, activating transcription and mediating protein-protein interactions [PMID:18449195] Human single-stranded DNA-binding protein 1 (hSSB1), encoded by OBFC2B, is characterized as an essential factor for the initiation of DNA damage checkpoints and the maintenance of genomic stability [PMID:22940690].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10158 Product name: Recombinant human OBFC2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC107723 Sequence: MWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR Predict reactive species\nFull Name: oligonucleotide\/oligosaccharide-binding fold containing 2A\nCalculated Molecular Weight: 124 aa, 14 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC107723\nGene Symbol: OBFC2A\nGene ID (NCBI): 64859\nRRID: AB_2156021\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96AH0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971126953,"sku":"16719-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16719-1-ap","provider":"Iright","version":"1.0","type":"link"}