{"product_id":"proteintech-16720-1-ap","title":"Proteintech, 16720-1-AP, NDUFB11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB11 (16720-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB11 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16720-1-AP targets NDUFB11 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFB11(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial) is also named as neuronal protein 17.3(Np17.3) and belongs to the complex I NDUFB11 subunit family. This protein is involved in the transfer of electrons from NADH to the respiratory chain and play a role in the growth, maintenance, and survival of neurons. NDUFB11 has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10159 Product name: Recombinant human NDUFB11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-163 aa of BC107805 Sequence: ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa\nCalculated Molecular Weight: 163 aa, 18 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC107805\nGene Symbol: NDUFB11\nGene ID (NCBI): 54539\nRRID: AB_2298378\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NX14\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868907360425,"sku":"16720-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16720-1-ap","provider":"Iright","version":"1.0","type":"link"}