{"product_id":"proteintech-16773-1-ap","title":"Proteintech, 16773-1-AP, SCUBE3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCUBE3 (16773-1-AP) by Proteintech is a Polyclonal antibody targeting SCUBE3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16773-1-AP targets SCUBE3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  TT cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCUBE3 is a secreted glycoprotein that belongs to the SCUBE family. Members of the SCUBE family are secreted plasma membrane-associated proteins characterised by a N-terminal signal peptide sequence, multiple EGF domains, a N-linked glycosylated spacer region and a C-terminal CUB region. SCUBE3 may play a role in bone cell biology (PMID: 15234972). It may also has a role in the regulation of cardiac growth and remodeling responses (PMID: 17442284). Besides, SCUBE3 has been reported to be involved in lung cancer progression (PMID: 21441952; 23420440).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10085 Product name: Recombinant human SCUBE3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 643-992 aa of BC052263 Sequence: YYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSVDGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCSRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK Predict reactive species\nFull Name: signal peptide, CUB domain, EGF-like 3\nCalculated Molecular Weight: 992 aa, 109 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC052263\nGene Symbol: SCUBE3\nGene ID (NCBI): 222663\nRRID: AB_2285430\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IX30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869594800297,"sku":"16773-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16773-1-ap","provider":"Iright","version":"1.0","type":"link"}