{"product_id":"proteintech-16780-1-ap","title":"Proteintech, 16780-1-AP, DNAJB12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJB12 (16780-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB12 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16780-1-AP targets DNAJB12 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, A549 cells,  human brain tissue,  human kidney tissue,  human liver tissue,  MCF-7 cells,  MKN-45 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human stomach tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNAJB12 (JB12), a ER transmembrane chaperone, specifically interacts with Hsc70 to facilitate ER retention and delivery of membrane proteins for folding or degradation in the ERAD pathway. Hsc70 chaperone activities require the substrate targeting function of DNAJB12. DNAJB12 recruits specific substrates to contact Hsc70 and then stimulates its ATPase activity. (PMID: 34668642)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10193 Product name: Recombinant human DNAJB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-248 aa of BC011812 Sequence: AYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily B, member 12\nCalculated Molecular Weight: 375 aa, 42 kDa\nObserved Molecular Weight: 40-42 kDa\nGenBank Accession Number: BC011812\nGene Symbol: DNAJB12\nGene ID (NCBI): 54788\nRRID: AB_2094404\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NXW2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868916830377,"sku":"16780-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16780-1-ap","provider":"Iright","version":"1.0","type":"link"}