{"product_id":"proteintech-16787-1-ap","title":"Proteintech, 16787-1-AP, MED30 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED30 (16787-1-AP) by Proteintech is a Polyclonal antibody targeting MED30 in WB, IP, ELISA applications with reactivity to human,   mouse samples\n16787-1-AP targets MED30 in WB, IHC, IP, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, HEK-293 cells\nPositive IP detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMED30, also named as THRAP6 and TRAP25, is a component of the Mediator complex. MED30 has two isoforms with MW 16-20 kDa ad 20-25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10221 Product name: Recombinant human MED30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC008226 Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN Predict reactive species\nFull Name: mediator complex subunit 30\nCalculated Molecular Weight: 178 aa, 20 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC008226\nGene Symbol: MED30\nGene ID (NCBI): 90390\nRRID: AB_2142439\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96HR3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869002682537,"sku":"16787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16787-1-ap","provider":"Iright","version":"1.0","type":"link"}