{"product_id":"proteintech-16789-1-ap","title":"Proteintech, 16789-1-AP, HLA-DRB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HLA-DRB3 (16789-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DRB3 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n16789-1-AP targets HLA-DRB3 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells,  Ramos cells\nPositive IF\/ICC detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are heterodimers consisting of an alpha (DRA) and a beta (DRB) chain. HLA-DRB3 is a beta chain of MHC class II molecule expressed on the surface of antigen presenting cells (APC) like B cells, macrophages, and dendritic cells (PMID: 30192820). It is involved in adaptive immune responses by presenting peptide antigens to CD4+ T cells (PMID: 19830726).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10223 Product name: Recombinant human HLA-DRB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-228 aa of BC008987 Sequence: DTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKM Predict reactive species\nFull Name: major histocompatibility complex, class II, DR beta 3\nCalculated Molecular Weight: 266 aa, 30 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC008987\nGene Symbol: HLA-DRB3\nGene ID (NCBI): 3125\nRRID: AB_3085508\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P79483\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887668908201,"sku":"16789-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16789-1-ap","provider":"Iright","version":"1.0","type":"link"}