{"product_id":"proteintech-16839-1-ap","title":"Proteintech, 16839-1-AP, NIP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NIP7 (16839-1-AP) by Proteintech is a Polyclonal antibody targeting NIP7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n16839-1-AP targets NIP7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNip7 was initially identified in yeast as required for processing of the 27S pre-rRNA to form the mature 25S and 5.8S rRNAs (PMID: 9891085). It localizes to the nucleolus but was also found to sediment in the region of free 60S subunits in sucrose density gradients (PMID: 9891085). Experimental evidence suggests that the P. abyssi Nip7 may be an exosome regulatory factor. It binds preferentially to U- and AU-rich RNAs and strongly inhibits the exosome due to its association with both the exosome complex and the substrate RNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10526 Product name: Recombinant human NIP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC015941 Sequence: MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT Predict reactive species\nFull Name: nuclear import 7 homolog (S. cerevisiae)\nCalculated Molecular Weight: 180 aa, 20 kDa\nObserved Molecular Weight: 20-22 kDa\nGenBank Accession Number: BC015941\nGene Symbol: NIP7\nGene ID (NCBI): 51388\nRRID: AB_2153549\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887737163945,"sku":"16839-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16839-1-ap","provider":"Iright","version":"1.0","type":"link"}