{"product_id":"proteintech-16841-1-ap","title":"Proteintech, 16841-1-AP, SETBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SETBP1 (16841-1-AP) by Proteintech is a Polyclonal antibody targeting SETBP1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n16841-1-AP targets SETBP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSETBP1 is initially found to interact with SET, which is a small protein inhibitor for tumor suppressors PP2A and NM23-H1. There are existing two isoforms of SETBP1 and the molecular weight of isoform one is 170 kDa and another is 26 kDa. SET is fused with another gene CAN through chromosome translocation in a case of acute undifferentiated leukemia. SETBP1 may involve in chromosome translocation in a case of acute T-cell leukemia [PMID:17569777]. SETBP1 can cooperate with BCR\/ABL to transform committed myeloid progenitors normally lacking self-renewal capability into LSCs and cause development of myeloid leukemias resembling human CML myeloid blast crisis [PMID:22566606]. SETBP1 was shown to form a complex with SET and PP2A, enhancing the stability of SET and its inhibition of PP2A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10532 Product name: Recombinant human SETBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC062338 Sequence: MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERAMCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEV Predict reactive species\nFull Name: SET binding protein 1\nCalculated Molecular Weight: 175 kDa, 26 kDa\nObserved Molecular Weight: 170-180 kDa\nGenBank Accession Number: BC062338\nGene Symbol: SETBP1\nGene ID (NCBI): 26040\nRRID: AB_2185750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6X0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973519017,"sku":"16841-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16841-1-ap","provider":"Iright","version":"1.0","type":"link"}