{"product_id":"proteintech-16844-1-ap","title":"Proteintech, 16844-1-AP, OAT3\/SLC22A8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OAT3\/SLC22A8 (16844-1-AP) by Proteintech is a Polyclonal antibody targeting OAT3\/SLC22A8 in WB, ELISA applications with reactivity to human, mouse, rat samples\n16844-1-AP targets OAT3\/SLC22A8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse kidney tissue,  mouse liver tissue,  rat kidney tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOAT3 (encoded by SLC22A8) is widely distributed in the kidney, liver, choroid plexus, olfactory mucosa, brain, retina, and placenta, but it is pre-dominantly expressed on the basolateral membrane of renal tubular cells. OAT3 plays a crucial role in the uptake, distribution, and excretion of various endogenous\/exogenous substances.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9795 Product name: Recombinant human SLC22A8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-123 aa of bc022387 Sequence: MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKE Predict reactive species\nFull Name: solute carrier family 22 (organic anion transporter), member 8\nCalculated Molecular Weight: 542 aa, 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: bc022387\nGene Symbol: SLC22A8\nGene ID (NCBI): 9376\nRRID: AB_3663018\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TCC7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869568716969,"sku":"16844-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16844-1-ap","provider":"Iright","version":"1.0","type":"link"}