{"product_id":"proteintech-16883-1-ap","title":"Proteintech, 16883-1-AP, SPAG16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPAG16 (16883-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG16 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16883-1-AP targets SPAG16 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue,  mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPAG16 (also known as PF20) is an orthologue of Chlamydomonas PF20, a component of the alga axoneme central apparatus that is required for flagellar motility. SPAG16 is highly expressed in the testis, low abundant or absent from other tissues. The SPAG16 gene encodes two major proteins, a 71-kDa SPAG16L and a smaller 35-kDa SPAG16S nuclear protein that represents the C-terminus of SPAG16L. SPAG16L was detected abundantly in the cytoplasm, while SPAG16S was detected in both cytoplasm and nucleus. This antibody was raised against the N-terminal region of SPAG16 and mainly recognizes SPAG16L.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10348 Product name: Recombinant human SPAG16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC009614 Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYV Predict reactive species\nFull Name: sperm associated antigen 16\nCalculated Molecular Weight: 631 aa, 71 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC009614\nGene Symbol: SPAG16\nGene ID (NCBI): 79582\nRRID: AB_2194658\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N0X2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869603942569,"sku":"16883-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16883-1-ap","provider":"Iright","version":"1.0","type":"link"}