{"product_id":"proteintech-16900-1-ap","title":"Proteintech, 16900-1-AP, GALNTL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GALNTL2 (16900-1-AP) by Proteintech is a Polyclonal antibody targeting GALNTL2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n16900-1-AP targets GALNTL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  human liver tissue\nPositive IHC detected in: mouse small intestine tissue, human kidney tissue,  human testis tissue,  human placenta tissue,  human brain tissue,  human lung tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGALNTL2, also known as GALNT15, is a member of the polypeptide ppGalNAc-T family. It catalyzes the initial step in O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine residues on protein receptors. Though it shows weaker activity compared to GALNT2, it can transfer up to seven GalNAc residues to the Muc5AC peptide, suggesting cooperative action with other GALNT proteins. GALNTL2 is widely expressed, with high expression in tissues like the small intestine, placenta, spleen, cerebral cortex, and ovary.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10434 Product name: Recombinant human GALNTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 287-639 aa of BC014789 Sequence: ECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRKALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQNQDSHSPLDQETTLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQHLCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRFDQINAVDER Predict reactive species\nFull Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 2\nCalculated Molecular Weight: 639 aa, 73 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC014789\nGene Symbol: GALNTL2\nGene ID (NCBI): 117248\nRRID: AB_2263208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N3T1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887646986409,"sku":"16900-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16900-1-ap","provider":"Iright","version":"1.0","type":"link"}