{"product_id":"proteintech-16922-1-ap","title":"Proteintech, 16922-1-AP, Vitamin D binding protein Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Vitamin D binding protein (16922-1-AP) by Proteintech is a Polyclonal antibody targeting Vitamin D binding protein in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16922-1-AP targets Vitamin D binding protein in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human blood tissue, human blood,  rat eye tissue,  mouse eye tissue,  PC-3 cells,  human plasma,  mouse testis tissue\nPositive IHC detected in: human liver tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVitamin D binding protein is a sparsely glycosylated serum protein responsible for highly specific binding and tissue-specific delivery of vitamin D and its metabolites. In addition, it is also an actin scavenger, and is the precursor to the immunomodulatory protein, Gc-MAF. Vitamin D binding protein has been proposed to have significant roles in C5a chemotaxis, osteoclast development and possibly in macrophage activation\/recruitment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10286 Product name: Recombinant human VDBP,GC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-474 aa of BC057228 Sequence: KLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL Predict reactive species\nFull Name: group-specific component (vitamin D binding protein)\nCalculated Molecular Weight: 474 aa, 53 kDa\nObserved Molecular Weight: 52-58 kDa\nGenBank Accession Number: BC057228\nGene Symbol: Vitamin D binding protein\nGene ID (NCBI): 2638\nRRID: AB_10597098\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02774\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915191977,"sku":"16922-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16922-1-ap","provider":"Iright","version":"1.0","type":"link"}