{"product_id":"proteintech-16932-1-ap","title":"Proteintech, 16932-1-AP, AP1B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP1B1 (16932-1-AP) by Proteintech is a Polyclonal antibody targeting AP1B1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16932-1-AP targets AP1B1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, HEK-293 cells,  mouse liver tissue,  rat colon tissue,  rat liver tissue\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP1B1 is a subunit of the adaptor complex AP-1 and is a member of the adaptin protein family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10417 Product name: Recombinant human AP1B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 671-919 aa of BC046242 Sequence: NFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAYETILKN Predict reactive species\nFull Name: adaptor-related protein complex 1, beta 1 subunit\nCalculated Molecular Weight: 919 aa, 101 kDa\nObserved Molecular Weight: 101 kDa\nGenBank Accession Number: BC046242\nGene Symbol: AP1B1\nGene ID (NCBI): 162\nRRID: AB_2058204\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q10567\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868947173545,"sku":"16932-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16932-1-ap","provider":"Iright","version":"1.0","type":"link"}