{"product_id":"proteintech-16949-1-ap","title":"Proteintech, 16949-1-AP, CPLX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPLX3 (16949-1-AP) by Proteintech is a Polyclonal antibody targeting CPLX3 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n16949-1-AP targets CPLX3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IF-P detected in: rat eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCPLX3, also named as Complexin-3, is 158 amino acid protein, which belongs to the complexin\/synaphin family. CPLX3 localizes in the membrane and binds to the SNARE core complex containing SNAP25, VAMP2 and STX1A. CPLX3 positively regulates a late step in synaptic vesicle exocytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10571 Product name: Recombinant human CPLX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC018026 Sequence: MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM Predict reactive species\nFull Name: complexin 3\nCalculated Molecular Weight: 158 aa, 18 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC018026\nGene Symbol: CPLX3\nGene ID (NCBI): 594855\nRRID: AB_2084042\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVH0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869454061737,"sku":"16949-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16949-1-ap","provider":"Iright","version":"1.0","type":"link"}