{"product_id":"proteintech-16963-1-ap","title":"Proteintech, 16963-1-AP, MYL6B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL6B (16963-1-AP) by Proteintech is a Polyclonal antibody targeting MYL6B in WB, IHC, ELISA applications with reactivity to human, mouse samples\n16963-1-AP targets MYL6B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, mouse testis tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYL6B, also known as MLC1SA, is primarily found in a hexamer consisting of four light chains and two heavy chains. MYL6B is an essential light chain for non-muscle Myosin II (NMII) that is involved in the control of cell adhesion, cell migration and tissue architecture, cargo transport, and endocytosis (PMID: 29439719, 33817240).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10683 Product name: Recombinant human MYL6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC012425 Sequence: MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV Predict reactive species\nFull Name: myosin, light chain 6B, alkali, smooth muscle and non-muscle\nCalculated Molecular Weight: 208 aa, 23 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC012425\nGene Symbol: MYL6B\nGene ID (NCBI): 140465\nRRID: AB_3085512\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14649\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887730544809,"sku":"16963-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16963-1-ap","provider":"Iright","version":"1.0","type":"link"}