{"product_id":"proteintech-16968-1-ap","title":"Proteintech, 16968-1-AP, PDRG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDRG1 (16968-1-AP) by Proteintech is a Polyclonal antibody targeting PDRG1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16968-1-AP targets PDRG1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human kidney tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDRG1 codes for a novel protein called p53 and DNA damage-regulated protein 1. Human PDRG1 is predominantly expressed in normal testis and its expression can be induced by UV irradiation and be repressed by p53 [PMID14562055]. Recently, PDRG1 was identified as a novel tumor marker for multiple malignancies that is selectively regulated by genotoxic stress. Its expression was upregulated in multiple malignancies including cancers of the colon, rectum, ovary, lung, stomach, breast and uterus when compared to normal tissues [PMID: 21193842], suggesting its being a novel tumor marker that could play a role in cancer development and\/or progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, artemia sinica\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9109 Product name: Recombinant human PDRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC009334 Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG Predict reactive species\nFull Name: p53 and DNA damage regulated 1\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC009334\nGene Symbol: PDRG1\nGene ID (NCBI): 81572\nRRID: AB_2162082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NUG6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869421949097,"sku":"16968-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-16968-1-ap","provider":"Iright","version":"1.0","type":"link"}