{"product_id":"proteintech-17006-1-ap","title":"Proteintech, 17006-1-AP, MRPS15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPS15 (17006-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS15 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17006-1-AP targets MRPS15 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse liver tissue,  MCF-7 cells,  Raji cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRPS15, also named as RPMS15 or DC37, is a 257 amino acid protein, which belongs to the ribosomal protein S15P family. MRPS15 localizes in the Mitochondrion and is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. MRPS15 is involved into the mitochondrial proteins biosynthesis and ribosomal biogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10702 Product name: Recombinant human MRPS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC031336 Sequence: MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ Predict reactive species\nFull Name: mitochondrial ribosomal protein S15\nCalculated Molecular Weight: 257 aa, 30 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC031336\nGene Symbol: MRPS15\nGene ID (NCBI): 64960\nRRID: AB_2301068\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P82914\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868907131049,"sku":"17006-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-17006-1-ap","provider":"Iright","version":"1.0","type":"link"}